| Edit |   |
|---|
| Antigenic Specificity | C2orf42 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C2orf42 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C2orf42. This antibody reacts with human. The C2orf42 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the C terminal of C2ORF42. Peptide sequence ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV. |
|---|
| Other Names | chromosome 2 open reading frame 42 |
|---|
| Gene, Accession # | C2ORF42, Gene ID: 54980 |
|---|
| Catalog # | NBP1-70467-20ul |
|---|
| Price | |
|---|
| Order / More Info | C2orf42 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|