| Edit |   |
| Antigenic Specificity | WDR3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The WDR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR3. This antibody reacts with human. The WDR3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human WDR3The immunogen for this antibody is WDR3. Peptide sequence VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT. |
| Other Names | dJ776P7.2 (WD repeat domain 3), FLJ12796, WD repeat domain 3, WD repeat-containing protein 3 |
| Gene, Accession # | WDR3, Gene ID: 10885, Accession: NP_006775, SwissProt: NP_006775 |
| Catalog # | NBP1-79930-20ul |
| Price | |
| Order / More Info | WDR3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |