| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WDR19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR19. This antibody reacts with human. The WDR19 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human WDR19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HMEVEFAIRVYRRIGNVGIVMSLEQIKGIEDYNLLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQHWDSALQLAKHLAPDQ |
|---|
| Other Names | DYF-2, FLJ23127, IFT144, intraflagellar transport 144 homolog, KIAA1638Pwdmp, ORF26, Oseg6, PWDMP, WD repeat domain 19, WD repeat membrane protein PWDMP, WD repeat-containing protein 19 |
|---|
| Gene, Accession # | WDR19, Gene ID: 57728 |
|---|
| Catalog # | NBP2-58212 |
|---|
| Price | |
|---|
| Order / More Info | WDR19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|