| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | WDR11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR11. This antibody reacts with human. The WDR11 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human WDR11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCD |
|---|
| Other Names | Bromodomain and WD repeat-containing protein 2, BRWD2DKFZp434L1715, DR11, FLJ10506, FLJ42531, KIAA1351bromodomain and WD repeat domain containing 2, WD repeat domain 11, WD repeat domain 15, WD repeat-containing protein 11, WD repeat-containing protein 15, WDR15 |
|---|
| Gene, Accession # | WDR11, Gene ID: 55717 |
|---|
| Catalog # | NBP1-89930 |
|---|
| Price | |
|---|
| Order / More Info | WDR11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|