| Edit |   |
| Antigenic Specificity | Semenogelin II |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Semenogelin II Antibody from Novus Biologicals is a rabbit polyclonal antibody to Semenogelin II. This antibody reacts with human. The Semenogelin II Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human SEMG2. Peptide sequence GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH. |
| Other Names | semenogelin IISGIISemenogelin 2, semenogelin-2 |
| Gene, Accession # | SEMG2, Gene ID: 6407, Accession: NP_002999, SwissProt: NP_002999 |
| Catalog # | NBP1-80501-20ul |
| Price | |
| Order / More Info | Semenogelin II Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |