| 产品详情 |
| Edit |   |
| Antigenic Specificity | GRASP55 |
| Clone | CL2522 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GRASP55 Antibody (CL2522) from Novus Biologicals is a mouse monoclonal antibody to GRASP55. This antibody reacts with human. The GRASP55 Antibody (CL2522) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GRASP55 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV |
| Other Names | Golgi phosphoprotein 6, golgi reassembly stacking protein 2, 55 kDa, golgi reassembly stacking protein 2, 55kDa, Golgi reassembly-stacking protein of 55 kDa, GOLPH6DKFZp434D156, GRASP55FLJ13139, GRS2Golgi reassembly-stacking protein 2, p59 |
| Gene, Accession # | GORASP2, Gene ID: 26003, Accession: Q9H8Y8, SwissProt: Q9H8Y8 |
| Catalog # | NBP2-36769 |
| Price | |
| Order / More Info | GRASP55 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|