| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NMT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25255805). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NMT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMT1. This antibody reacts with human, mouse, rat. The NMT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH |
|---|
| Other Names | alternative, short form NMT-S, glycylpeptide N-tetradecanoyltransferase 1, long form, NMT-L, Myristoyl-CoA:protein N-myristoyltransferase 1, NMT 1, NMTEC 2.3.1.97, N-myristoyltransferase 1, Peptide N-myristoyltransferase 1, Type I N-myristoyltransferase |
|---|
| Gene, Accession # | NMT1, Gene ID: 4836 |
|---|
| Catalog # | NBP1-82547 |
|---|
| Price | |
|---|
| Order / More Info | NMT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25255805 |
|---|
| 产品资料 |
|
|