| Edit |   |
|---|
| Antigenic Specificity | NMRAL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NMRAL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMRAL1. This antibody reacts with human. The NMRAL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NMRAL1(NmrA-like family domain containing 1) The peptide sequence was selected from the middle region of NMRAL1. Peptide sequence TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA. |
|---|
| Other Names | HSCARGFLJ25918, NmrA-like family domain containing 1, nmrA-like family domain-containing protein 1, SDR48A1, short chain dehydrogenase/reductase family 48A, member 1 |
|---|
| Gene, Accession # | NMRAL1, Gene ID: 57407, Accession: Q9HBL8, SwissProt: Q9HBL8 |
|---|
| Catalog # | NBP1-56439 |
|---|
| Price | |
|---|
| Order / More Info | NMRAL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|