| Edit |   |
| Antigenic Specificity | NMRAL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NMRAL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMRAL1. This antibody reacts with human. The NMRAL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to NMRAL1(NmrA-like family domain containing 1) The peptide sequence was selected from the middle region of NMRAL1. Peptide sequence TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA. |
| Other Names | HSCARGFLJ25918, NmrA-like family domain containing 1, nmrA-like family domain-containing protein 1, SDR48A1, short chain dehydrogenase/reductase family 48A, member 1 |
| Gene, Accession # | NMRAL1, Gene ID: 57407, Accession: Q9HBL8, SwissProt: Q9HBL8 |
| Catalog # | NBP1-56439-20ul |
| Price | |
| Order / More Info | NMRAL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |