| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NMNAT-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NMNAT-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NMNAT-1. This antibody reacts with human, mouse. The NMNAT-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NMNAT1(nicotinamide nucleotide adenylyltransferase 1) The peptide sequence was selected from the N terminal of NMNAT1 (NP_073624). Peptide sequence PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL. |
|---|
| Other Names | EC 2.7.7.1, EC 2.7.7.18, NaMN adenylyltransferase 1, nicotinamide mononucleotide adenylyltransferase 1, nicotinamide nucleotide adenylyltransferase, nicotinamide nucleotide adenylyltransferase 1, Nicotinate-nucleotide adenylyltransferase 1, NMN adenylyltransferase 1, NMNATPNAT1, pyridine nucleotide adenylyltransferase 1 |
|---|
| Gene, Accession # | NMNAT1, Gene ID: 64802, Accession: Q9HAN9, SwissProt: Q9HAN9 |
|---|
| Catalog # | NBP1-52973 |
|---|
| Price | |
|---|
| Order / More Info | NMNAT-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24360282, 24739386 |
|---|
| 产品资料 |
|
|