| 产品详情 |
| Edit |   |
| Antigenic Specificity | EPRS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EPRS Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPRS. This antibody reacts with human, rat. The EPRS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat EPRS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAEIKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELA |
| Other Names | bifunctional aminoacyl-tRNA synthetase, Cell proliferation-inducing gene 32 protein, DKFZp313B047, EARS, EC 6.1.1, EC 6.1.1.15, EC 6.1.1.18, GLNS, GLUPRORS, glutamate tRNA ligase, glutaminyl-tRNA synthetase, glutamyl-prolyl-tRNA synthetase, PARSproliferation-inducing gene 32 protein, proliferation-inducing protein 32, proline tRNA ligase, proline-tRNA ligase, prolyl-tRNA synthetase, QARS, QPRS |
| Gene, Accession # | EPRS, Gene ID: 2058 |
| Catalog # | NBP1-84929 |
| Price | |
| Order / More Info | EPRS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|