| Edit |   |
|---|
| Antigenic Specificity | MARVELD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MARVELD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MARVELD2. This antibody reacts with human. The MARVELD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MARVELD2(MARVEL domain containing 2) The peptide sequence was selected from the middle region of MARVELD2. Peptide sequence PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL. |
|---|
| Other Names | MARVEL domain containing 2, MRVLDC2, TRICautosomal recessive 49 |
|---|
| Gene, Accession # | MARVELD2, Gene ID: 153562, Accession: C9J8H4, SwissProt: C9J8H4 |
|---|
| Catalog # | NBP1-59434-20ul |
|---|
| Price | |
|---|
| Order / More Info | MARVELD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|