| 产品详情 |
| Edit |   |
| Antigenic Specificity | MASTL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MASTL Antibody from Novus Biologicals is a rabbit polyclonal antibody to MASTL. This antibody reacts with human. The MASTL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MASTL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGLTVEVQDLKLSVHKSQQNDCANKEN |
| Other Names | FLJ14813EC 2.7.11.1, GREATWALL, GW, GWL, hGWL, MAST-L, microtubule associated serine/threonine kinase-like, Microtubule-associated serine/threonine-protein kinase-like, RP11-85G18.2, THC2greatwall protein kinase |
| Gene, Accession # | MASTL, Gene ID: 84930 |
| Catalog # | NBP1-83680 |
| Price | |
| Order / More Info | MASTL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24391510 |
| 产品资料 |
|
|