| Edit |   |
|---|
| Antigenic Specificity | Lactase-like Protein/LCTL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lactase-like Protein/LCTL Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lactase-like Protein/LCTL. This antibody reacts with human. The Lactase-like Protein/LCTL Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Lactase-like Protein/LCTL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SIWDVFTHSGKGKVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSW |
|---|
| Other Names | FLJ33279, KLG, klotho gamma, Klotho/lactase-phlorizin hydrolase-related protein, KLPHKL lactase phlorizin hydrolase, lactase-like, lactase-like protein |
|---|
| Gene, Accession # | LCTL, Gene ID: 197021 |
|---|
| Catalog # | NBP2-57392 |
|---|
| Price | |
|---|
| Order / More Info | Lactase-like Protein/LCTL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|