| Edit |   |
| Antigenic Specificity | Eukaryotic translation initiation factor 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Eukaryotic translation initiation factor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Eukaryotic translation initiation factor 1. This antibody reacts with human. The Eukaryotic translation initiation factor 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Eukaryotic translation initiation factor 1 - middle region. Peptide sequence DKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAK. |
| Other Names | A121Protein translation factor SUI1 homolog, eIF1, EIF-1, EIF1A, eukaryotic translation initiation factor 1, ISO1, Sui1iso1, SUI1sui1iso1 |
| Gene, Accession # | EIF1, Gene ID: 10209, Accession: NP_005792, SwissProt: NP_005792 |
| Catalog # | NBP1-98556 |
| Price | |
| Order / More Info | Eukaryotic translation initiation factor 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |