| Edit |   |
|---|
| Antigenic Specificity | MCTP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCTP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCTP1. This antibody reacts with human. The MCTP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY. |
|---|
| Other Names | FLJ22344, multiple C2 and transmembrane domain-containing protein 1, multiple C2 domains, transmembrane 1, multiple C2-domains with two transmembrane regions 1 |
|---|
| Gene, Accession # | MCTP1, Gene ID: 79772, Accession: Q6DN14-2, SwissProt: Q6DN14-2 |
|---|
| Catalog # | NBP1-59908-20ul |
|---|
| Price | |
|---|
| Order / More Info | MCTP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|