| Edit |   |
| Antigenic Specificity | NUP37 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NUP37 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUP37. This antibody reacts with mouse. The NUP37 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the N terminal of Nup37. Immunizing peptide sequence EEETDIEGIQYKTLRTFHHGVRVDGIAWSPETKLDSLPPVIKFCTSAADL. |
| Other Names | MGC5585, nucleoporin 37kDa, nucleoporin Nup37, Nup107-160 subcomplex subunit Nup37, p37FLJ22618 |
| Gene, Accession # | NUP37, Gene ID: 79023, Accession: Q9CWU9 |
| Catalog # | NBP1-74146 |
| Price | |
| Order / More Info | NUP37 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |