| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUP214 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUP214 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUP214. This antibody reacts with human. The NUP214 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NUP214 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY |
|---|
| Other Names | 214 kDa nucleoporin, CAINputative oncogene, D9S46Enuclear pore complex protein Nup214, KIAA0023, MGC104525, N214, nucleoporin 214kD (CAIN), nucleoporin 214kDa, Nucleoporin Nup214, p250, Protein CAN |
|---|
| Gene, Accession # | NUP214, Gene ID: 8021 |
|---|
| Catalog # | NBP2-58412 |
|---|
| Price | |
|---|
| Order / More Info | NUP214 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|