| Edit |   |
|---|
| Antigenic Specificity | FBXO36 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FBXO36 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO36. This antibody reacts with human. The FBXO36 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FBXO36(F-box protein 36) The peptide sequence was selected from the N terminal of FBXO36. Peptide sequence QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD. |
|---|
| Other Names | F-box only protein 36, F-box protein 36, FBX36, FLJ37592, FLJ41090 |
|---|
| Gene, Accession # | FBXO36, Gene ID: 130888, Accession: Q8NEA4, SwissProt: Q8NEA4 |
|---|
| Catalog # | NBP1-57616 |
|---|
| Price | |
|---|
| Order / More Info | FBXO36 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|