| Edit |   |
| Antigenic Specificity | FBXO33 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXO33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO33. This antibody reacts with human. The FBXO33 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FBXO33(F-box protein 33) The peptide sequence was selected from the middle region of FBXO33. Peptide sequence VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL. |
| Other Names | BMND12, c14_5247, F-box only protein 33, F-box protein 33, Fbx33 |
| Gene, Accession # | FBXO33, Gene ID: 254170, Accession: Q7Z6M2, SwissProt: Q7Z6M2 |
| Catalog # | NBP1-57619 |
| Price | |
| Order / More Info | FBXO33 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |