| Edit |   |
|---|
| Antigenic Specificity | VAT1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VAT1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to VAT1L. This antibody reacts with human. The VAT1L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human VAT1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL |
|---|
| Other Names | KIAA1576synaptic vesicle membrane protein VAT-1 homolog-like, vesicle amine transport protein 1 homolog (T. californica)-like, vesicle amine transport protein 1 homolog-like (T. californica) |
|---|
| Gene, Accession # | VAT1L, Gene ID: 57687 |
|---|
| Catalog # | NBP1-92570 |
|---|
| Price | |
|---|
| Order / More Info | VAT1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|