| Edit |   |
|---|
| Antigenic Specificity | VAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VAT1. This antibody reacts with human. The VAT1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to VAT1 (vesicle amine transport protein 1 homolog (T. californica)) The peptide sequence was selected from the N terminal of VAT1. Peptide sequence PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA. |
|---|
| Other Names | FLJ20230, membrane protein of cholinergic synaptic vesicles, synaptic vesicle membrane protein VAT-1 homolog, VATI, vesicle amine transport protein 1 homolog (T. californica) |
|---|
| Gene, Accession # | VAT1, Gene ID: 10493, Accession: Q99536, SwissProt: Q99536 |
|---|
| Catalog # | NBP1-57008 |
|---|
| Price | |
|---|
| Order / More Info | VAT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|