| Edit |   |
| Antigenic Specificity | TP53I13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TP53I13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TP53I13. This antibody reacts with human. The TP53I13 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE. |
| Other Names | DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13 |
| Gene, Accession # | TP53I13, Gene ID: 90313, Accession: NP_612358, SwissProt: NP_612358 |
| Catalog # | NBP1-79465 |
| Price | |
| Order / More Info | TP53I13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |