| 产品详情 |
| Edit |   |
| Antigenic Specificity | PDHX |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PDHX Antibody from Novus Biologicals is a rabbit polyclonal antibody to PDHX. This antibody reacts with human. The PDHX Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PDHX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLS |
| Other Names | Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenasecomplex, DLDBP, E3-binding protein, E3BPpyruvate dehydrogenase complex, E3-binding protein subunit, OPDX, PDX1Lipoyl-containing pyruvate dehydrogenase complex component X, proXpyruvate dehydrogenase complex, lipoyl-containing component X, pyruvate dehydrogenase complex, component X, pyruvate dehydrogenase protein X component, mitochondrial |
| Gene, Accession # | PDHX, Gene ID: 8050 |
| Catalog # | NBP1-84079 |
| Price | |
| Order / More Info | PDHX Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|