| 产品详情 |
| Edit |   |
| Antigenic Specificity | Slit3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Slit3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Slit3. This antibody reacts with human. The Slit3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Slit3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG QVVREVIRRQKGYASCATASKVPIMECRG |
| Other Names | KIAA0814, MEGF5Multiple epidermal growth factor-like domains protein 5, Multiple EGF-like domains protein 5, SLIL2, SLIL2FLJ10764, slit homolog 3 (Drosophila), slit homolog 3 protein, SLIT1, slit2, Slit-3slit (Drosophila) homolog 3 |
| Gene, Accession # | SLIT3, Gene ID: 6586 |
| Catalog # | NBP2-13350 |
| Price | |
| Order / More Info | Slit3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|