| 产品详情 |
| Edit |   |
| Antigenic Specificity | TFF1/pS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TFF1/pS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TFF1/pS2. This antibody reacts with human. The TFF1/pS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TFF1/pS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPE |
| Other Names | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
| Gene, Accession # | TFF1, Gene ID: 7031 |
| Catalog # | NBP1-90813 |
| Price | |
| Order / More Info | TFF1/pS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 18853439, 20124221, 20132413, 22042635 |
| 产品资料 |
|
|