| 产品详情 |
| Edit |   |
| Antigenic Specificity | RIMS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RIMS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RIMS2. This antibody reacts with human. The RIMS2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RIMS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS |
| Other Names | DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3IP3, regulating synaptic membrane exocytosis 2, regulating synaptic membrane exocytosis protein 2, RIM 2 |
| Gene, Accession # | RIMS2, Gene ID: 9699 |
| Catalog # | NBP2-56512 |
| Price | |
| Order / More Info | RIMS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|