| Edit |   |
| Antigenic Specificity | RILP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RILP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RILP. This antibody reacts with human. The RILP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is RILP - C-terminal region. Peptide sequence FGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCL. |
| Other Names | rab-interacting lysosomal protein, PP10141, Rab interacting lysosomal protein |
| Gene, Accession # | RILP, Gene ID: 83547, Accession: NP_113618, SwissProt: NP_113618 |
| Catalog # | NBP1-98279 |
| Price | |
| Order / More Info | RILP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |