| Edit |   |
|---|
| Antigenic Specificity | RILP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RILP Antibody from Novus Biologicals is a rabbit polyclonal antibody to RILP. This antibody reacts with human. The RILP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is RILP - C-terminal region. Peptide sequence FGLWYRGKAESSEDETSSPAPSKLGGEEEAQPQSPAPDPPCSALHEHLCL. |
|---|
| Other Names | rab-interacting lysosomal protein, PP10141, Rab interacting lysosomal protein |
|---|
| Gene, Accession # | RILP, Gene ID: 83547, Accession: NP_113618, SwissProt: NP_113618 |
|---|
| Catalog # | NBP1-98279-20ul |
|---|
| Price | |
|---|
| Order / More Info | RILP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|