| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIF4GD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIF4GD Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIF4GD. This antibody reacts with human. The MIF4GD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MIF4GD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL |
|---|
| Other Names | AD023, hSLIP1, MGC45027, MIF4G domain containing, MIFD, SLBP (stem loop binding protein)-interacting protein 1, SLBP-interacting protein 1, SLIP1MIF4G domain-containing protein |
|---|
| Gene, Accession # | MIF4GD, Gene ID: 57409, Accession: A9UHW6, SwissProt: A9UHW6 |
|---|
| Catalog # | NBP2-30627 |
|---|
| Price | |
|---|
| Order / More Info | MIF4GD Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|