| 产品详情 |
| Edit |   |
| Antigenic Specificity | p38 beta/MAPK11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The p38 beta/MAPK11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p38 beta/MAPK11. This antibody reacts with human. The p38 beta/MAPK11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human p38 beta/MAPK11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA |
| Other Names | EC 2.7.11, EC 2.7.11.24, MAP kinase 11, MAP kinase p38 beta, MAPK 11, mitogen-activated protein kinase 11, Mitogen-activated protein kinase p38 beta, mitogen-activated protein kinase p38-2, p38b, p38Beta, P38BETA2, PRKM11, SAPK2B, SAPK2p38-2P38B, Stress-activated protein kinase 2, stress-activated protein kinase-2, stress-activated protein kinase-2b |
| Gene, Accession # | MAPK11, Gene ID: 5600 |
| Catalog # | NBP2-48826 |
| Price | |
| Order / More Info | p38 beta/MAPK11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|