| 产品详情 |
| Edit |   |
| Antigenic Specificity | PBEF/Visfatin/NAMPT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PBEF/Visfatin/NAMPT Antibody from Novus Biologicals is a rabbit polyclonal antibody to PBEF/Visfatin/NAMPT. This antibody reacts with human. The PBEF/Visfatin/NAMPT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PBEF/Visfatin/NAMPT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGED |
| Other Names | EC 2.4.2.12, MGC117256, NAmPRTase, Nampt, nicotinamide phosphoribosyltransferase, PBEF1110035O14Rik, PBEF1DKFZp666B131, Pre-B cell-enhancing factor, pre-B-cell colony enhancing factor 1, Pre-B-cell colony-enhancing factor 1, VF, VISFATIN |
| Gene, Accession # | NAMPT, Gene ID: 10135, Accession: P43490 |
| Catalog # | NBP2-46755 |
| Price | |
| Order / More Info | PBEF/Visfatin/NAMPT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|