| 产品详情 |
| Edit |   |
| Antigenic Specificity | EAAT1/GLAST-1/SLC1A3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EAAT1/GLAST-1/SLC1A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EAAT1/GLAST-1/SLC1A3. This antibody reacts with human. The EAAT1/GLAST-1/SLC1A3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EAAT1/GLAST-1/SLC1A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVK |
| Other Names | EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3 |
| Gene, Accession # | SLC1A3, Gene ID: 6507 |
| Catalog # | NBP1-84940 |
| Price | |
| Order / More Info | EAAT1/GLAST-1/SLC1A3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|