| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DZIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DZIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DZIP3. This antibody reacts with human. The DZIP3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DZIP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESTMKTYVSKLNAETSRALTAEVYFLQCRRDFGLLHLEQTEKECLNQLARVTHMAASNLESLQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQ |
|---|
| Other Names | DAZ interacting protein 3, zinc finger, DAZ-interacting protein 3, E3 ubiquitin-protein ligase DZIP3, EC 6.3.2.-, FLJ13327, FLJ57977, FLJ58022, FLJ58223, hRUL138KIAA0675, human RNA-binding ubiquitin ligase of 138 kDa, RNA-binding ubiquitin ligase of 138 kDa, UURF2, UURF2 ubiquitin ligase, zinc finger DAZ interacting protein 3 |
|---|
| Gene, Accession # | DZIP3, Gene ID: 9666 |
|---|
| Catalog # | NBP2-58053 |
|---|
| Price | |
|---|
| Order / More Info | DZIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|