| Edit |   |
|---|
| Antigenic Specificity | MICALL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MICALL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MICALL1. This antibody reacts with human. The MICALL1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MICALL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGNKRDAK |
|---|
| Other Names | DKFZp686M2226, KIAA1668, MICAL-L1, MICAL-like 1, MICAL-like protein 1 |
|---|
| Gene, Accession # | MICALL1, Gene ID: 85377 |
|---|
| Catalog # | NBP2-55389 |
|---|
| Price | |
|---|
| Order / More Info | MICALL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|