| Edit |   |
| Antigenic Specificity | LDHD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LDHD Antibody from Novus Biologicals is a rabbit polyclonal antibody to LDHD. This antibody reacts with human. The LDHD Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LDHD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKR |
| Other Names | D-lactate dehydrogenase, EC 1.1.2.4, lactate dehydrogenase DDLD, MGC57726, probable D-lactate dehydrogenase, mitochondrial |
| Gene, Accession # | LDHD, Gene ID: 197257, Accession: Q86WU2, SwissProt: Q86WU2 |
| Catalog # | NBP2-30523 |
| Price | |
| Order / More Info | LDHD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |