| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LDB3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LDB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LDB3. This antibody reacts with human. The LDB3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LDB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIGLYSAETLREMAQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQ AVIKSQNKPEDEADEWARRSSNLQS |
|---|
| Other Names | CMD1C, CYPHER, KIAA01613, KIAA0613FLJ35865, LDB3Z1, LDB3Z4, LIM domain binding 3, LIM domain-binding protein 3, ORACLE, PDLIM6, PDZ and LIM domain 6, Protein cypher, ZASPLVNC3, Z-band alternatively spliced PDZ-motif protein |
|---|
| Gene, Accession # | LDB3, Gene ID: 11155 |
|---|
| Catalog # | NBP2-14190 |
|---|
| Price | |
|---|
| Order / More Info | LDB3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|