| Edit |   |
| Antigenic Specificity | Buster3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Buster3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Buster3. This antibody reacts with human. The Buster3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LOC63920 (chromosome 5 open reading frame 54) The peptide sequence was selected from the N terminal of LOC63920)(50ug). Peptide sequence SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV. |
| Other Names | Buster3, chromosome 5 open reading frame 54 |
| Gene, Accession # | C5orf54, Gene ID: 63920 |
| Catalog # | NBP1-70425 |
| Price | |
| Order / More Info | Buster3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |