| Edit |   |
|---|
| Antigenic Specificity | Buster3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Buster3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Buster3. This antibody reacts with human. The Buster3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC63920 (chromosome 5 open reading frame 54) The peptide sequence was selected from the N terminal of LOC63920)(50ug). Peptide sequence SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV. |
|---|
| Other Names | Buster3, chromosome 5 open reading frame 54 |
|---|
| Gene, Accession # | C5orf54, Gene ID: 63920 |
|---|
| Catalog # | NBP1-70425-20ul |
|---|
| Price | |
|---|
| Order / More Info | Buster3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|