| Edit |   |
| Antigenic Specificity | UFSP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UFSP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UFSP2. This antibody reacts with human. The UFSP2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C4ORF20 The peptide sequence was selected from the middle region of C4ORF20. Peptide sequence YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD. |
| Other Names | FLJ11200, UFM1-specific peptidase 2, ufm1-specific protease 2 |
| Gene, Accession # | UFSP2, Gene ID: 55325 |
| Catalog # | NBP1-70740 |
| Price | |
| Order / More Info | UFSP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |