| Edit |   |
| Antigenic Specificity | UFM1 Activating Enzyme/UBA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UFM1 Activating Enzyme/UBA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UFM1 Activating Enzyme/UBA5. This antibody reacts with mouse. The UFM1 Activating Enzyme/UBA5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Uba5 - N-terminal region. Peptide sequence LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN. |
| Other Names | FLJ17281, FLJ23251UBA5, ThiFP1, UBE1DC1ubiquitin-activating enzyme E1 homolog, ubiquitin-like modifier activating enzyme 5, ubiquitin-like modifier-activating enzyme 5, UFM1-activating enzyme |
| Gene, Accession # | UBA5, Gene ID: 79876, Accession: NP_079968 |
| Catalog # | NBP1-98392 |
| Price | |
| Order / More Info | UFM1 Activating Enzyme/UBA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |