| Edit |   |
|---|
| Antigenic Specificity | UFM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UFM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UFM1. This antibody reacts with human. The UFM1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human UFM1The immunogen for this antibody is UFM1. Peptide sequence LSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH. |
|---|
| Other Names | bA131P10.1, BM-002, C13orf20, chromosome 13 open reading frame 20, ubiquitin-fold modifier 1 |
|---|
| Gene, Accession # | UFM1, Gene ID: 51569, Accession: NP_057701, SwissProt: NP_057701 |
|---|
| Catalog # | NBP1-79760-20ul |
|---|
| Price | |
|---|
| Order / More Info | UFM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|