| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HOGA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HOGA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HOGA1. This antibody reacts with human. The HOGA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HOGA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEFPFLTSSERLEVVSRVRQAMPKNRLLLAGSGCESTQATVEMTVSMAQ VGADAAMVVTPCYYRGRMSS |
|---|
| Other Names | 4-hydroxy-2-oxoglutarate aldolase 1, C10orf65, chromosome 10 open reading frame 65, DHDPS2, DHDPSLHP3, DHDPS-like protein, Dihydrodipicolinate synthase-like, dihydrodipicolinate synthase-like, mitochondrial, dihydrodipicolinate synthetase homolog 2, EC 4.1.3.16, FLJ37472, FLJ56960, N-acetylneuraminate pyruvate lyase 2 (putative), NPL2, Probable 2-keto-4-hydroxyglutarate aldolase, probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial, Probable KHG-aldolase, Protein 569272 |
|---|
| Gene, Accession # | HOGA1, Gene ID: 112817 |
|---|
| Catalog # | NBP2-14097 |
|---|
| Price | |
|---|
| Order / More Info | HOGA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|