| Edit |   |
|---|
| Antigenic Specificity | HNRPLL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HNRPLL Antibody from Novus Biologicals is a rabbit polyclonal antibody to HNRPLL. This antibody reacts with human. The HNRPLL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HNRPLL(heterogeneous nuclear ribonucleoprotein L-like) The peptide sequence was selected from the N terminal of HNRPLL. Peptide sequence MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGG. |
|---|
| Other Names | heterogeneous nuclear ribonucleoprotein L-like, hnRNPLL, SRRF, stromal RNA regulating factor, Stromal RNA-regulating factor |
|---|
| Gene, Accession # | HNRPLL, Gene ID: 92906, Accession: Q8WVV9, SwissProt: Q8WVV9 |
|---|
| Catalog # | NBP1-57407-20ul |
|---|
| Price | |
|---|
| Order / More Info | HNRPLL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|