| Edit |   |
| Antigenic Specificity | TIGAR/C12orf5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TIGAR/C12orf5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIGAR/C12orf5. This antibody reacts with human. The TIGAR/C12orf5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIGAR/C12orf5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTET |
| Other Names | chromosome 12 open reading frame 5, EC 3.1.3.46, probable fructose-2,6-bisphosphatase TIGAR, TIGARTP53-induced glycolysis and apoptosis regulator, transactivated by NS3TP2 protein |
| Gene, Accession # | TIGAR, Gene ID: 57103, Accession: Q9NQ88, SwissProt: Q9NQ88 |
| Catalog # | NBP2-38462 |
| Price | |
| Order / More Info | TIGAR/C12orf5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |