| 产品详情 |
| Edit |   |
| Antigenic Specificity | GOLGB1/Giantin |
| Clone | 6D4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GOLGB1/Giantin Antibody (6D4) from Novus Biologicals is a mouse monoclonal antibody to GOLGB1/Giantin. This antibody reacts with human. The GOLGB1/Giantin Antibody (6D4) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | GOLGB1 (NP_004478 3 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN |
| Other Names | 372 kDa Golgi complex-associated protein, GCP, GCP372GIANTIN, giantin, golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal)1,macrogolgin, golgi integral membrane protein 1, golgin B1, golgin B1, golgi integral membrane protein, Golgin subfamily B member 1, GOLIM1, Macrogolgin |
| Gene, Accession # | GOLGB1, Gene ID: 2804, Accession: NP_004478, SwissProt: NP_004478 |
| Catalog # | H00002804-M01 |
| Price | |
| Order / More Info | GOLGB1/Giantin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|