| Edit |   |
| Antigenic Specificity | PCDHGB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCDHGB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCDHGB3. This antibody reacts with human. The PCDHGB3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PCDHGB3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FTQDMYRVNVAENLPAGSSVLKVMAIDMDEGINAEIIYAFINIGKEVRQLFKLDSKTGELTTIGELDFEERDSYTIGVEA |
| Other Names | protocadherin gamma-B3, PCDH-GAMMA-B3, protocadherin gamma subfamily B, 3 |
| Gene, Accession # | PCDHGB3, Gene ID: 56102, Accession: Q9Y5G1, SwissProt: Q9Y5G1 |
| Catalog # | NBP2-32022 |
| Price | |
| Order / More Info | PCDHGB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |