| 产品详情 |
| Edit |   |
| Antigenic Specificity | NKG2D/CD314 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NKG2D/CD314 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NKG2D/CD314. This antibody reacts with human. The NKG2D/CD314 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NKG2D/CD314 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNAS |
| Other Names | CD314, CD314 antigen, D12S2489E, FLJ17759, FLJ75772, Killer cell lectin-like receptor subfamily K member 1, killer cell lectin-like receptor subfamily K, member 1, KLR, NK cell receptor D, NKG2-D, NKG2-D type II integral membrane protein, NKG2-D-activating NK receptor, NKG2DDNA segment on chromosome 12 (unique) 2489 expressed sequence |
| Gene, Accession # | KLRK1, Gene ID: 22914 |
| Catalog # | NBP2-56979 |
| Price | |
| Order / More Info | NKG2D/CD314 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|