| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Septin-9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Septin-9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Septin-9. This antibody reacts with human. The Septin-9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Septin-9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS |
|---|
| Other Names | AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1 |
|---|
| Gene, Accession # | SEPT9, Gene ID: 10801 |
|---|
| Catalog # | NBP2-55358 |
|---|
| Price | |
|---|
| Order / More Info | Septin-9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|