| 产品详情 |
| Edit |   |
| Antigenic Specificity | Septin-7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Septin-7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Septin-7. This antibody reacts with human, mouse, rat. The Septin-7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Septin-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPW |
| Other Names | CDC10 cell division cycle 10 homolog, CDC10 cell division cycle 10 homolog (S. cerevisiae), CDC10 protein homolog, CDC10S. cerevisiae, homolog), Nbla02942, septin 7, septin-7 |
| Gene, Accession # | SEPT7, Gene ID: 989 |
| Catalog # | NBP1-85731 |
| Price | |
| Order / More Info | Septin-7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|